PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PH01000005G1660
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
Family GRF
Protein Properties Length: 390aa    MW: 41978 Da    PI: 9.1481
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PH01000005G1660genomeICBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC72.35.5e-23137180245
              WRC   2 aepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkskee 45 
                       epgrCrRtDGKkWRCsr++++++k+CErH++rgr+rsrk++e 
  PH01000005G1660 137 VEPGRCRRTDGKKWRCSRDAVGDQKYCERHVNRGRHRSRKHVEG 180
                      59***************************************996 PP

2QLQ61.81.9e-2183119137
              QLQ   1 saFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37 
                      ++FT++Q+++L++Q+l+yK++aan+PvP+ Ll++i++
  PH01000005G1660  83 GPFTPTQWMELEHQALIYKHFAANAPVPSSLLLPIRR 119
                      59*********************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009516.9E-1383119IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166623.66784119IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088804.5E-1584118IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166723.998136180IPR014977WRC domain
PfamPF088792.2E-19138179IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 390 aa     Download sequence    Send to blast
MATLGSCGGH PSLQQEHGGC DEQARQDGLL KVARALPPPP SCSFLGSTVS SGVQMLSFSS  60
NDAAGLGLSS GASMQGVLAR VRGPFTPTQW MELEHQALIY KHFAANAPVP SSLLLPIRRS  120
LHPWVGWGPF RPGCADVEPG RCRRTDGKKW RCSRDAVGDQ KYCERHVNRG RHRSRKHVEG  180
REATRTIAEP AMAVPGGVLS RSHAVARQQQ VKGSAANVTD PFSRQSNRKL LEKQNVVDQL  240
SVSTPMDSFD FSSSYSSQNC DKVALSPLKL HHDHDQAYIA HGVGSSSEKG NKSQESRLPV  300
SRETLDDGPL GEVFKSKSCQ SASADISTDK WTESPKLHSP TGILQMTTKF SSESSSSTVN  360
IGPAPENHIT SNGYLTARMA NSQTVPTLL*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015615703.10.0PREDICTED: growth-regulating factor 8
SwissprotQ6AWY10.0GRF8_ORYSJ; Growth-regulating factor 8
TrEMBLA0A0E0MGA40.0A0A0E0MGA4_ORYPU; Uncharacterized protein
STRINGORGLA11G0141300.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP129602731
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37740.11e-37growth-regulating factor 2